PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g23300.2.p
Common NameBRADI_5g23300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 783aa    MW: 85799.4 Da    PI: 6.8096
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g23300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28398449152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+isl++l+kyFs+++kdAAk+Lgvc+T+LKriCR +GI+RWP+Rki+++
  Bradi5g23300.2.p 398 AEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRAHGISRWPSRKINKV 449
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557812.94E-539118IPR029016GAF domain-like
PROSITE profilePS5151916.893388469IPR003035RWP-RK domain
PfamPF020426.3E-26401449IPR003035RWP-RK domain
SuperFamilySSF542773.27E-23679765No hitNo description
Gene3DG3DSA:3.10.20.2401.9E-22679761No hitNo description
SMARTSM006664.5E-21682764IPR000270PB1 domain
PROSITE profilePS5174524.31682764IPR000270PB1 domain
PfamPF005642.8E-18683763IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MPVEQEGHAV LSTSDQPFLL DQSLAGYREV SRNFVFSAKE ETGLHPGLPG RVFISGVPEW  60
TSNVLYYSKP EYLRMEYALH HEVRGSLAMP IYDPSKGSCC AVLELITKRE KPDFNAEMDN  120
VRQALQAVNL KTTKDCSNQK FYTENQKAAF TEILDVLRAI CHAHMLPLAL TWVPMSNGID  180
GAYVVGRDGG LGSQSGKEIL CVHESACYVN DAKMKGFFHA CAESPLEKGQ GIAGRALKSN  240
LPFFSPNIRE YNIKDYPLAH HARKFGLHAA VAIRLRSTYT GNDDYILEFF LPINCKGSEE  300
QQMLLNNLSS TMQRICKSLR TVAESEVDKV DARNAVLYKT TSESVSPTGH SESSSHCDKP  360
ITEASFQDLS LVDKQGYMEP EQVQSSSMRL AEKKRSTAEK NISLDVLRKY FSGSLKDAAK  420
SLGVCPTTLK RICRAHGISR WPSRKINKVN RSLKKIQTVI NSVHGVDSSL QYDPGTGSLV  480
PAASLPEKRP ASSTDALPAL SSGKTVEQKS VPKSEQAYSS PDGWQSESYQ VQLSDAEKGE  540
GGEFHMQTSN HSDIGNHTSY GANVTPHVSP EGTQGQSYPV GTVSAFHPKE TGCVSPFVSA  600
RPTAENTGDQ IVGRNSPSLQ QADIDMVDDA FQKTNMVDDH EAREHTHPST SGMTDSSSGS  660
ASSHPTFKKE PGHALKGKSG PTLTVKATYN GDTVRFKFLP SQGWYQLLEE IAKRFKLSTG  720
TFQLKYKDDE DEWVILANDS DLQECVEVMD SMGSCNVKLQ VRDLPCLISS SSGSSTCLRL  780
PT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240492.10.0PREDICTED: protein NLP2-like
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLA0A0Q3IF860.0A0A0Q3IF86_BRADI; Uncharacterized protein
TrEMBLI1J2C50.0I1J2C5_BRADI; Uncharacterized protein
STRINGBRADI5G23300.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-176Nin-like family protein